Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 7(PCR7)

https://www.flytf.org/web/image/product.template/117047/image_1920?unique=59ef7fb
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9LS43 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MEKQWTSGLFSCMEDSETACLTCFCPCVTFGRIADISDEGRTGCGRCGVFYGLICCVVGL PCLFSCTYRTKIRSKFGLPESPTSDCVTHFFCECCALCQEHRELKTRGLDPSIGWSGNMQ RTMAPPMSQQMMG Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 7 Short name= AtPCR7 Gene Names: Name: PCR7 Ordered Locus Names: At3g18470 ORF Names: MYF24.19 Expression Region: 1-133 Sequence Info: full length protein

1,062.00 1062.0 USD 1,062.00

1,062.00

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days