Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 6(PCR6)

https://www.flytf.org/web/image/product.template/117046/image_1920?unique=59ef7fb
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9M9A5 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MGRPDQTPSPRMNNNFNPVFHAQSEQPVDEKRVLQAEQIYPNNGGVVNQPNQVPMRPGPP TYINQSATFNQPYGVSMAGPVHTQPSNWTSGLFDCMNDGENALITCCFPFVTFGQIAEVI DEGATSCGTAGMLYGLICCLFAIPCVYTCTFRTKLRSKYGLPDAPAPDWITHCFCEYCAL CQEYRELKNRGLDPSIGWIGNVQKQRMGQQQEMMAPPMGQRMMG Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 6 Short name= AtPCR6 Gene Names: Name: PCR6 Ordered Locus Names: At1g49030 ORF Names: F27J15.18 Expression Region: 1-224 Sequence Info: full length protein

1,131.12 1131.12 USD 1,131.12

1,131.12

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days